SCOPe 2.06: Domain d5lwkb_: 5lwk B:

Lineage for d5lwkb_ (5lwk B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Lactobacillus paracasei [TaxId:1597] [336049] (2 PDB entries)

8. Domain d5lwkb_: 5lwk B: [336104]
   automated match to d1zh4a_
   complexed with bef, mg

Details for d5lwkb_

PDB Entry: 5lwk, 2.11 Å

PDB Description: maer response regulator bound to beryllium trifluoride

PDB Compounds: (B:) transcriptional regulatory protein

SCOPe Domain Sequences for d5lwkb_:

Sequence; same for both SEQRES and ATOM records:

>d5lwkb_ c.23.1.0 (B:) automated matches {Lactobacillus paracasei [TaxId: 1597]}
mtniliveddpmvqfihrnylekigtfdtiyssetiadakkllasrsiqlvlldirlkdg
ngidfltdlrrtkqtvdvilitaanevnivndalhlgvidylikpftlerfeksiqryrt
kh

Timeline for d5lwkb_:

• d5lwkb_ is new in SCOPe 2.06-stable
  
• d5lwkb_ appears in SCOPe 2.07
  
• d5lwkb_ appears in the current release, SCOPe 2.08