SCOPe 2.08: Domain d5mwne1: 5mwn E:1-118

Lineage for d5mwne1 (5mwn E:1-118)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
Domain d5mwne1: 5mwn E:1-118 [336090]
Other proteins in same PDB: d5mwnd2, d5mwne2, d5mwnf2
automated match to d4ldeb_
complexed with po4

Details for d5mwne1

PDB Entry: 5mwn (more details), 2.2 Å

PDB Description: structure of the eaec t6ss component tssk n-terminal domain in complex with llama nanobodies nbk18 and nbk27

PDB Compounds: (E:) llama nanobody raised against TssK, nbK18

SCOPe Domain Sequences for d5mwne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mwne1 b.1.1.1 (E:1-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggtlklscaasgsisgivvmawyrqapgkqrelvasitsggttnya
dsvkgrftiskdnaentlylrmnslkpedtavyyckaffrrdyvgydywgqgtqvtvs

SCOPe Domain Coordinates for d5mwne1:

Click to download the PDB-style file with coordinates for d5mwne1.
(The format of our PDB-style files is described here.)

Timeline for d5mwne1: