SCOPe 2.06: Domain d5hw1a_: 5hw1 A:

Lineage for d5hw1a_ (5hw1 A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (59 PDB entries)

8. Domain d5hw1a_: 5hw1 A: [336088]
   automated match to d1m40a_
   complexed with xe

Details for d5hw1a_

PDB Entry: 5hw1, 1.7 Å

PDB Description: crystal structure of tem1 beta-lactamase in the presence of 1.2 mpa xenon

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d5hw1a_:

Sequence; same for both SEQRES and ATOM records:

>d5hw1a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d5hw1a_:

• d5hw1a_ is new in SCOPe 2.06-stable
  
• d5hw1a_ appears in SCOPe 2.07
  
• d5hw1a_ appears in the current release, SCOPe 2.08