SCOPe 2.08: Domain d5nckb2: 5nck B:124-291

Lineage for d5nckb2 (5nck B:124-291)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Fusobacterium nucleatum [TaxId:851] [336084] (1 PDB entry)

8. Domain d5nckb2: 5nck B:124-291 [336086]
   automated match to d4htla2

Details for d5nckb2

PDB Entry: 5nck, 2.23 Å

PDB Description: the crystal structure of n-acetylmannosamine kinase in fusobacterium nucleatum

PDB Compounds: (B:) N-acetylmannosamine kinase

SCOPe Domain Sequences for d5nckb2:

Sequence; same for both SEQRES and ATOM records:

>d5nckb2 c.55.1.0 (B:124-291) automated matches {Fusobacterium nucleatum [TaxId: 851]}
lsnficltigtgigggillnnqlfrgenfvagefghilikkgefeqfasttalirlvker
tgktlngkeifdlekkeileyqeiisewienltdglssiiycfnpaniilgggvieqgep
linriknslfkkigpqfkeklnitqaklgnnagmigasylllekinkr

Timeline for d5nckb2:

• d5nckb2 first appeared in SCOPe 2.06
  
• d5nckb2 appears in SCOPe 2.07