Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Fusobacterium nucleatum [TaxId:851] [336084] (1 PDB entry) |
Domain d5nckb2: 5nck B:124-291 [336086] automated match to d4htla2 |
PDB Entry: 5nck (more details), 2.23 Å
SCOPe Domain Sequences for d5nckb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nckb2 c.55.1.0 (B:124-291) automated matches {Fusobacterium nucleatum [TaxId: 851]} lsnficltigtgigggillnnqlfrgenfvagefghilikkgefeqfasttalirlvker tgktlngkeifdlekkeileyqeiisewienltdglssiiycfnpaniilgggvieqgep linriknslfkkigpqfkeklnitqaklgnnagmigasylllekinkr
Timeline for d5nckb2: