SCOPe 2.07: Domain d5lhqb1: 5lhq B:6-135

Lineage for d5lhqb1 (5lhq B:6-135)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries)

8. Domain d5lhqb1: 5lhq B:6-135 [336068]
   Other proteins in same PDB: d5lhqa_, d5lhqb2
   automated match to d3cx5j_
   complexed with 0gj, edo, so4

Details for d5lhqb1

PDB Entry: 5lhq, 2.6 Å

PDB Description: the egr-cmk active site inhibited catalytic domain of murine urokinase-type plasminogen activator in complex with the allosteric inhibitory nanobody nb7

PDB Compounds: (B:) Camelid-Derived Antibody Fragment Nb7

SCOPe Domain Sequences for d5lhqb1:

Sequence; same for both SEQRES and ATOM records:

>d5lhqb1 b.1.1.0 (B:6-135) automated matches {Vicugna pacos [TaxId: 30538]}
esggglvqpggslrlscaasgftlgyyaigwfrrapgkeregvscisssggstnyadsvk
grftisrdnakntvdlqmnslkpedtaiyycaaewvppgygatvqalcnnagygmeywgk
gtqvtvssaa

Timeline for d5lhqb1:

• d5lhqb1 first appeared in SCOPe 2.06, called d5lhqb_
  
• d5lhqb1 appears in the current release, SCOPe 2.08