Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [276396] (23 PDB entries) |
Domain d5lhqb1: 5lhq B:6-135 [336068] Other proteins in same PDB: d5lhqa_, d5lhqb2 automated match to d3cx5j_ complexed with 0gj, edo, so4 |
PDB Entry: 5lhq (more details), 2.6 Å
SCOPe Domain Sequences for d5lhqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5lhqb1 b.1.1.0 (B:6-135) automated matches {Vicugna pacos [TaxId: 30538]} esggglvqpggslrlscaasgftlgyyaigwfrrapgkeregvscisssggstnyadsvk grftisrdnakntvdlqmnslkpedtaiyycaaewvppgygatvqalcnnagygmeywgk gtqvtvssaa
Timeline for d5lhqb1: