Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
Superfamily d.13.1: HIT-like [54197] (6 families) |
Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [224916] (19 PDB entries) |
Domain d5km0d_: 5km0 D: [336047] automated match to d3tw2a_ complexed with imp |
PDB Entry: 5km0 (more details), 1.53 Å
SCOPe Domain Sequences for d5km0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5km0d_ d.13.1.1 (D:) Histidine triad nucleotide-binding protein (HINT) {Human (Homo sapiens) [TaxId: 9606]} dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
Timeline for d5km0d_: