Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (28 species) not a true protein |
Species Talaromyces verruculosus [TaxId:198730] [330334] (6 PDB entries) |
Domain d5l9cd_: 5l9c D: [336041] automated match to d1h1na_ complexed with nag |
PDB Entry: 5l9c (more details), 1.85 Å
SCOPe Domain Sequences for d5l9cd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l9cd_ c.1.8.3 (D:) automated matches {Talaromyces verruculosus [TaxId: 198730]} ssfewfgsnesgaefgsgnipgvegtdytfpnttaiqilidagmnifrvpflmermipte mtgsldtayfegysevinyitgkgahavvdphnfgryygtpisstsdfqtfwstlasqfk sndlvifdtnneyhdmdesvvvalnqaaidgirdagattqyifvegnaysgawtwttynt amvnltdpsdlivyemhqyldsdgsgtsdqcvsstvgqervvdattwlqsngklgilgef aggansvceeavegmldylaensdvwlgaswwsagpwwqdyiysmeppngiayesylsil etyf
Timeline for d5l9cd_: