![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (12 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (4 proteins) |
![]() | Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (85 PDB entries) |
![]() | Domain d2hmia1: 2hmi A:430-558 [33604] Other proteins in same PDB: d2hmia2, d2hmib_, d2hmic1, d2hmic2, d2hmid1, d2hmid2 protein/protein/DNA complex; mutant |
PDB Entry: 2hmi (more details), 2.8 Å
SCOP Domain Sequences for d2hmia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hmia1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsagirk
Timeline for d2hmia1: