Lineage for d2hmia1 (2hmi A:430-558)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246268Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 246278Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 246279Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)
  8. 246336Domain d2hmia1: 2hmi A:430-558 [33604]
    Other proteins in same PDB: d2hmia2, d2hmib_, d2hmic1, d2hmic2, d2hmid1, d2hmid2
    protein/protein/DNA complex; mutant

Details for d2hmia1

PDB Entry: 2hmi (more details), 2.8 Å

PDB Description: hiv-1 reverse transcriptase/fragment of fab 28/dna complex

SCOP Domain Sequences for d2hmia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmia1 c.55.3.1 (A:430-558) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOP Domain Coordinates for d2hmia1:

Click to download the PDB-style file with coordinates for d2hmia1.
(The format of our PDB-style files is described here.)

Timeline for d2hmia1: