SCOPe 2.08: Domain d5i52b_: 5i52 B:

Lineage for d5i52b_ (5i52 B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (63 PDB entries)

8. Domain d5i52b_: 5i52 B: [336022]
   automated match to d1erma_
   mutant

Details for d5i52b_

PDB Entry: 5i52, 1.75 Å

PDB Description: crystal structure of tem1 beta-lactamase mutant i263n

PDB Compounds: (B:) Beta-lactamase TEM

SCOPe Domain Sequences for d5i52b_:

Sequence; same for both SEQRES and ATOM records:

>d5i52b_ e.3.1.1 (B:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivvnyttg
sqatmdernrqiaeigaslikhw

Timeline for d5i52b_:

• d5i52b_ first appeared in SCOPe 2.06
  
• d5i52b_ appears in SCOPe 2.07