SCOPe 2.06: Domain d5i63c_: 5i63 C:

Lineage for d5i63c_ (5i63 C:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (59 PDB entries)

8. Domain d5i63c_: 5i63 C: [336010]
   automated match to d1erma_
   complexed with xe; mutant

Details for d5i63c_

PDB Entry: 5i63, 1.95 Å

PDB Description: crystal structure of tem1 beta-lactamase mutant i263n in the presence of 1.2 mpa xenon

PDB Compounds: (C:) Beta-lactamase TEM

SCOPe Domain Sequences for d5i63c_:

Sequence; same for both SEQRES and ATOM records:

>d5i63c_ e.3.1.1 (C:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdtttpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivvnyttg
sqatmdernrqiaeigaslikhw

Timeline for d5i63c_:

• d5i63c_ is new in SCOPe 2.06-stable
  
• d5i63c_ appears in SCOPe 2.07
  
• d5i63c_ appears in the current release, SCOPe 2.08