Lineage for d5km7a_ (5km7 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176031Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2176032Superfamily d.13.1: HIT-like [54197] (5 families) (S)
  5. 2176033Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 protein domains)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2176102Protein automated matches [191082] (2 species)
    not a true protein
  7. 2176108Species Human (Homo sapiens) [TaxId:9606] [189791] (38 PDB entries)
  8. 2176125Domain d5km7a_: 5km7 A: [336008]
    automated match to d3tw2a_
    complexed with d5m

Details for d5km7a_

PDB Entry: 5km7 (more details), 1.25 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint1) 2'-deoxy- amp complex
PDB Compounds: (A:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5km7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5km7a_ d.13.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d5km7a_:

Click to download the PDB-style file with coordinates for d5km7a_.
(The format of our PDB-style files is described here.)

Timeline for d5km7a_:

  • d5km7a_ appears in periodic updates to SCOPe 2.06 starting on 2017-06-29
  • d5km7a_ became obsolete in SCOPe 2.07