Lineage for d5gj2a1 (5gj2 A:96-356)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160971Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2161281Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2161282Protein automated matches [190944] (35 species)
    not a true protein
  7. 2161351Species Roseiflexus sp. [TaxId:357808] [335988] (3 PDB entries)
  8. 2161353Domain d5gj2a1: 5gj2 A:96-356 [336002]
    Other proteins in same PDB: d5gj2a2
    automated match to d2r7ab_
    complexed with mg

Details for d5gj2a1

PDB Entry: 5gj2 (more details), 2.4 Å

PDB Description: periplasmic heme-binding protein rhut from roseiflexus sp. rs-1 in apo form
PDB Compounds: (A:) periplasmic binding protein

SCOPe Domain Sequences for d5gj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gj2a1 c.92.2.0 (A:96-356) automated matches {Roseiflexus sp. [TaxId: 357808]}
erivslngditeiifalgmgeyvvgvdssatyppertkmlpnigyqrrlsaegilslnpt
lvigdeaagppetlaqiraagvplaitadppsldapqqkirfvaqalgipqrgerlaaqv
eaeiaaardlarritnpphvlflylrgtdvqqvagrntavdvmiaaagginaaadagive
fkplspevviaaqpdvllvldkglesvggvdgllkipgladtpagrqrriialddlyllg
mgprtgqaltdltiafydaaq

SCOPe Domain Coordinates for d5gj2a1:

Click to download the PDB-style file with coordinates for d5gj2a1.
(The format of our PDB-style files is described here.)

Timeline for d5gj2a1:

  • d5gj2a1 is new in SCOPe 2.06-stable
  • d5gj2a1 does not appear in SCOPe 2.07

View in 3D
Domains from same chain:
(mouse over for more information)
d5gj2a2