Lineage for d5km0c_ (5km0 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929711Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 2929712Superfamily d.13.1: HIT-like [54197] (6 families) (S)
  5. 2929713Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins)
    Pfam PF01230
    topologically similar to the N-terminal domain of protein kinases
  6. 2929724Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species)
  7. 2929725Species Human (Homo sapiens) [TaxId:9606] [224916] (19 PDB entries)
  8. 2929748Domain d5km0c_: 5km0 C: [336000]
    automated match to d3tw2a_
    complexed with imp

Details for d5km0c_

PDB Entry: 5km0 (more details), 1.53 Å

PDB Description: human histidine triad nucleotide binding protein 1 (hhint) imp complex
PDB Compounds: (C:) Histidine triad nucleotide-binding protein 1

SCOPe Domain Sequences for d5km0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5km0c_ d.13.1.1 (C:) Histidine triad nucleotide-binding protein (HINT) {Human (Homo sapiens) [TaxId: 9606]}
gdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesll
ghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg

SCOPe Domain Coordinates for d5km0c_:

Click to download the PDB-style file with coordinates for d5km0c_.
(The format of our PDB-style files is described here.)

Timeline for d5km0c_: