Lineage for d5gita_ (5git A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2513276Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2513277Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2513558Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2513559Protein automated matches [190710] (4 species)
    not a true protein
  7. 2513560Species Human (Homo sapiens) [TaxId:9606] [187857] (47 PDB entries)
  8. 2513620Domain d5gita_: 5git A: [335985]
    automated match to d4cxta_
    complexed with xxt

Details for d5gita_

PDB Entry: 5git (more details), 2.19 Å

PDB Description: btb domain of keap1 in complex with xx3
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d5gita_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gita_ d.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tfsytledhtkqafgimnelrlsqqlcdvtlqvkyqdapaaqfmahkvvlassspvfkam
ftnglreqgmevvsiegihpkvmerliefaytasismgekcvlhvmngavmyqidsvvra
cadflvqqld

SCOPe Domain Coordinates for d5gita_:

Click to download the PDB-style file with coordinates for d5gita_.
(The format of our PDB-style files is described here.)

Timeline for d5gita_: