Lineage for d5gj0a1 (5gj0 A:40-305)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160971Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2161281Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2161282Protein automated matches [190944] (35 species)
    not a true protein
  7. 2161297Species Burkholderia cenocepacia [TaxId:216591] [335925] (5 PDB entries)
  8. 2161304Domain d5gj0a1: 5gj0 A:40-305 [335981]
    Other proteins in same PDB: d5gj0a2, d5gj0b2
    automated match to d2r7ab_
    complexed with act, hem, so4

Details for d5gj0a1

PDB Entry: 5gj0 (more details), 2.4 Å

PDB Description: periplasmic heme-binding protein bhut one-heme bound form (holo-1)
PDB Compounds: (A:) Putative hemin transport system, substrate-binding protein

SCOPe Domain Sequences for d5gj0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gj0a1 c.92.2.0 (A:40-305) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
krviviggalaetafalggaetpryrlvgadttctypdaakrlpkvgyqralsaegllsl
rpdlvlasaeagpptaiaqvkgagvtvttfderhdvesvrakitgvaqaldvrdagaall
qrfdrdwqaardavaarvpggaqpprvlfvlnhtgtqalvagqrtaadamiryagarnam
qgfdhykplttealaaaapdvvlisdeglaavgghaallatpgfgatpagrarrvvslda
lfllgfgprlplavttlhrrlsdala

SCOPe Domain Coordinates for d5gj0a1:

Click to download the PDB-style file with coordinates for d5gj0a1.
(The format of our PDB-style files is described here.)

Timeline for d5gj0a1:

  • d5gj0a1 is new in SCOPe 2.06-stable
  • d5gj0a1 does not appear in SCOPe 2.07

View in 3D
Domains from same chain:
(mouse over for more information)
d5gj0a2