SCOP 1.57: Domain d3hvta1: 3hvt A:430-556

Lineage for d3hvta1 (3hvt A:430-556)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (50 PDB entries)

8. Domain d3hvta1: 3hvt A:430-556 [33598]
   Other proteins in same PDB: d3hvta2, d3hvtb1

Details for d3hvta1

PDB Entry: 3hvt, 2.9 Å

PDB Description: structural basis of asymmetry in the human immunodeficiency virus type 1 reverse transcriptase heterodimer

SCOP Domain Sequences for d3hvta1:

Sequence; same for both SEQRES and ATOM records:

>d3hvta1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

Timeline for d3hvta1:

• d3hvta1 first appeared (with stable ids) in SCOP 1.55
  
• d3hvta1 appears in SCOP 1.59
  
• d3hvta1 appears in the current release, SCOPe 2.08