Lineage for d1bqma1 (1bqm A:430-556)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246268Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 246278Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)
  7. 246279Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (65 PDB entries)
  8. 246339Domain d1bqma1: 1bqm A:430-556 [33597]
    Other proteins in same PDB: d1bqma2, d1bqmb_
    complexed with hby; mutant

Details for d1bqma1

PDB Entry: 1bqm (more details), 3.1 Å

PDB Description: hiv-1 rt/hby 097

SCOP Domain Sequences for d1bqma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bqma1 c.55.3.1 (A:430-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagi

SCOP Domain Coordinates for d1bqma1:

Click to download the PDB-style file with coordinates for d1bqma1.
(The format of our PDB-style files is described here.)

Timeline for d1bqma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bqma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1bqmb_