Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d5x2ml1: 5x2m L:1-111 [335914] Other proteins in same PDB: d5x2ma_, d5x2mb_, d5x2mc_, d5x2md1, d5x2mh_, d5x2mj_, d5x2mk2, d5x2ml2 automated match to d1kegl1 complexed with ca, cl, gln, na, nag |
PDB Entry: 5x2m (more details), 2.21 Å
SCOPe Domain Sequences for d5x2ml1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x2ml1 b.1.1.0 (L:1-111) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspaslavslgqratiscrasesvdsygnsfmhwyqqkpgqppillisrasnles giparfsgsgsrtdftltinpveaddfatyycqqtnedprtfgggtkleik
Timeline for d5x2ml1: