SCOP 1.69: Domain d1rdhb1: 1rdh B:432-556

Lineage for d1rdhb1 (1rdh B:432-556)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (10 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries)

8. Domain d1rdhb1: 1rdh B:432-556 [33589]
   CA-atoms only

Details for d1rdhb1

PDB Entry: 1rdh, 2.8 Å

PDB Description: crystallographic analyses of an active hiv-1 ribonuclease h domain show structural features that distinguish it from the inactive form

SCOP Domain Sequences for d1rdhb1:

Sequence, based on SEQRES records:

>d1rdhb1 c.55.3.1 (B:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsagi

Sequence, based on observed residues (ATOM records):

>d1rdhb1 c.55.3.1 (B:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpaiggneqvdklvsa
gi

Timeline for d1rdhb1:

• d1rdhb1 first appeared (with stable ids) in SCOP 1.55
  
• d1rdhb1 appears in SCOP 1.67
  
• d1rdhb1 appears in SCOP 1.71
  
• d1rdhb1 appears in the current release, SCOPe 2.08