SCOPe 2.06: Domain d5x2mk2: 5x2m K:112-216

Lineage for d5x2mk2 (5x2m K:112-216)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d5x2mk2: 5x2m K:112-216 [335880]
   Other proteins in same PDB: d5x2mk1, d5x2ml1
   automated match to d1p7kl2
   complexed with ca, cl, gln, na, nag

Details for d5x2mk2

PDB Entry: 5x2m, 2.21 Å

PDB Description: crystal structure of the medaka fish taste receptor t1r2a-t1r3 ligand binding domains in complex with l-glutamine

PDB Compounds: (K:) Fab16A Light chain

SCOPe Domain Sequences for d5x2mk2:

Sequence; same for both SEQRES and ATOM records:

>d5x2mk2 b.1.1.2 (K:112-216) automated matches {Mus musculus [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d5x2mk2:

• d5x2mk2 is new in SCOPe 2.06-stable
  
• d5x2mk2 appears in SCOPe 2.07
  
• d5x2mk2 appears in the current release, SCOPe 2.08