SCOPe 2.08: Domain d5v8zc1: 5v8z C:158-254

Lineage for d5v8zc1 (5v8z C:158-254)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.71: ERP29 C domain-like [47932] (2 superfamilies)
   5 helices; bundle

4. Superfamily a.71.1: ERP29 C domain-like [47933] (2 families)
   automatically mapped to Pfam PF07749

5. Family a.71.1.1: ERP29 C domain-like [47934] (3 proteins)

6. Protein automated matches [335837] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [335838] (1 PDB entry)

8. Domain d5v8zc1: 5v8z C:158-254 [335839]
   Other proteins in same PDB: d5v8za2, d5v8zc2
   automated match to d1g7da_

Details for d5v8zc1

PDB Entry: 5v8z, 2.11 Å

PDB Description: crystal structure of erp29 d-domain in complex with the p-domain of calmegin

PDB Compounds: (C:) Endoplasmic reticulum resident protein 29

SCOPe Domain Sequences for d5v8zc1:

Sequence; same for both SEQRES and ATOM records:

>d5v8zc1 a.71.1.1 (C:158-254) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpvydalagefirasgvearqallkqgqdnlssvketqkkwaeqylkimgkildqgedfp
asemtriarlieknkmsdgkkeelqkslniltafqkk

Timeline for d5v8zc1:

• d5v8zc1 first appeared in SCOPe 2.06
  
• d5v8zc1 appears in SCOPe 2.07