Lineage for d5up8a_ (5up8 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990639Species Human (Homo sapiens) [TaxId:9606] [187027] (25 PDB entries)
  8. 1990678Domain d5up8a_: 5up8 A: [335814]
    automated match to d4ml5a_
    complexed with byd, na, zn

Details for d5up8a_

PDB Entry: 5up8 (more details), 2.63 Å

PDB Description: crystal structure of the zn-bound human heavy-chain variant 122h-delta c-star with para-benzenedihydroxamate
PDB Compounds: (A:) ferritin heavy chain

SCOPe Domain Sequences for d5up8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5up8a_ a.25.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
stsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahd
kndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsd

SCOPe Domain Coordinates for d5up8a_:

Click to download the PDB-style file with coordinates for d5up8a_.
(The format of our PDB-style files is described here.)

Timeline for d5up8a_: