Lineage for d1rtja1 (1rtj A:430-543)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1859087Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1859138Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 1859148Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (101 PDB entries)
    Uniprot P04585 159-692 # chain A coverage; chain B is shorter: 162-582 ! Uniprot P03366 186-725 # chain A coverage; chain B coverage: 156-584 ! Uniprot P04585 158-698 # chain A coverage; chain B is shorter: 159-595
  8. 1859166Domain d1rtja1: 1rtj A:430-543 [33581]
    Other proteins in same PDB: d1rtja2, d1rtjb1

Details for d1rtja1

PDB Entry: 1rtj (more details), 2.35 Å

PDB Description: mechanism of inhibition of hiv-1 reverse transcriptase by non-nucleoside inhibitors
PDB Compounds: (A:) hiv-1 reverse transcriptase

SCOPe Domain Sequences for d1rtja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rtja1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

SCOPe Domain Coordinates for d1rtja1:

Click to download the PDB-style file with coordinates for d1rtja1.
(The format of our PDB-style files is described here.)

Timeline for d1rtja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rtja2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rtjb1