Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (2 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (80 PDB entries) |
Domain d1rtja1: 1rtj A:430-543 [33581] Other proteins in same PDB: d1rtja2, d1rtjb1 |
PDB Entry: 1rtj (more details), 2.35 Å
SCOP Domain Sequences for d1rtja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rtja1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig
Timeline for d1rtja1: