SCOP 1.57: Domain d1rt2a1: 1rt2 A:430-543

Lineage for d1rt2a1 (1rt2 A:430-543)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (50 PDB entries)

8. Domain d1rt2a1: 1rt2 A:430-543 [33580]
   Other proteins in same PDB: d1rt2a2, d1rt2b1

Details for d1rt2a1

PDB Entry: 1rt2, 2.55 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase complexed with tnk- 651

SCOP Domain Sequences for d1rt2a1:

Sequence; same for both SEQRES and ATOM records:

>d1rt2a1 c.55.3.1 (A:430-543) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig

Timeline for d1rt2a1:

• d1rt2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1rt2a1 appears in SCOP 1.59
  
• d1rt2a1 appears in the current release, SCOPe 2.08