Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d5t0yb2: 5t0y B:128-232 [335794] Other proteins in same PDB: d5t0yb1, d5t0yg1, d5t0yl1 automated match to d1p7kl2 complexed with so4 |
PDB Entry: 5t0y (more details), 3.01 Å
SCOPe Domain Sequences for d5t0yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t0yb2 b.1.1.2 (B:128-232) automated matches {Mus musculus [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d5t0yb2:
View in 3D Domains from other chains: (mouse over for more information) d5t0yg1, d5t0yg2, d5t0yl1, d5t0yl2 |