Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (28 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
Domain d5t0yb1: 5t0y B:1-127 [335792] Other proteins in same PDB: d5t0yb2, d5t0yg2, d5t0yl2 automated match to d1kegl1 complexed with so4 |
PDB Entry: 5t0y (more details), 3.01 Å
SCOPe Domain Sequences for d5t0yb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t0yb1 b.1.1.0 (B:1-127) automated matches {Mus musculus [TaxId: 10090]} diqmtqttsslsaslgdrvtiscsasqgisnylnwyqqkpdgtvkllifytstlysgvps rfsgsgsgtdysltisnlepediatyycqqysrfpyvfgggtkleik
Timeline for d5t0yb1:
View in 3D Domains from other chains: (mouse over for more information) d5t0yg1, d5t0yg2, d5t0yl1, d5t0yl2 |