SCOP 1.57: Domain d1hrha1: 1hrh A:432-556

Lineage for d1hrha1 (1hrh A:432-556)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (50 PDB entries)

8. Domain d1hrha1: 1hrh A:432-556 [33577]

Details for d1hrha1

PDB Entry: 1hrh, 2.4 Å

PDB Description: crystal structure of the ribonuclease h domain of hiv-1 reverse transcriptase

SCOP Domain Sequences for d1hrha1:

Sequence, based on SEQRES records:

>d1hrha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvdkl
vsagi

Sequence, based on observed residues (ATOM records):

>d1hrha1 c.55.3.1 (A:432-556) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
epivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqdsgl
evnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpggneqvdklvsagi

Timeline for d1hrha1:

• d1hrha1 first appeared (with stable ids) in SCOP 1.55
  
• d1hrha1 appears in SCOP 1.59
  
• d1hrha1 appears in the current release, SCOPe 2.08