Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) |
Family c.55.3.1: Ribonuclease H [53099] (3 proteins) |
Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species) |
Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries) |
Domain d1vrua1: 1vru A:430-539 [33575] Other proteins in same PDB: d1vrua2, d1vrub1 |
PDB Entry: 1vru (more details), 2.4 Å
SCOP Domain Sequences for d1vrua1:
Sequence, based on SEQRES records: (download)
>d1vrua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
>d1vrua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1} ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq yalgiiqaqpdqseselvnqiieqlikkekvylawvpah
Timeline for d1vrua1: