Lineage for d1vrua1 (1vru A:430-539)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 124260Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 124495Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
  5. 124496Family c.55.3.1: Ribonuclease H [53099] (3 proteins)
  6. 124506Protein HIV RNase H (Domain of reverse transcriptase) [53105] (1 species)
  7. 124507Species Human immunodeficiency virus type 1 [TaxId:11676] [53106] (57 PDB entries)
  8. 124510Domain d1vrua1: 1vru A:430-539 [33575]
    Other proteins in same PDB: d1vrua2, d1vrub1

Details for d1vrua1

PDB Entry: 1vru (more details), 2.4 Å

PDB Description: high resolution structures of hiv-1 rt from four rt-inhibitor complexes

SCOP Domain Sequences for d1vrua1:

Sequence, based on SEQRES records: (download)

>d1vrua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah

Sequence, based on observed residues (ATOM records): (download)

>d1vrua1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1}
ekepivgaetfyvdagyvtnrgrqkvvtltdttnqktelqaiylalqdsglevnivtdsq
yalgiiqaqpdqseselvnqiieqlikkekvylawvpah

SCOP Domain Coordinates for d1vrua1:

Click to download the PDB-style file with coordinates for d1vrua1.
(The format of our PDB-style files is described here.)

Timeline for d1vrua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vrua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vrub1