SCOPe 2.08: Domain d5neta2: 5net A:439-594

Lineage for d5neta2 (5net A:439-594)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.0: automated matches [233856] (1 protein)
   not a true family

6. Protein automated matches [233857] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)

8. Domain d5neta2: 5net A:439-594 [335742]
   Other proteins in same PDB: d5net1_, d5net3_, d5neta1
   automated match to d1m1xa1
   complexed with ca, man, nag

Details for d5neta2

PDB Entry: 5net, 8.6 Å

PDB Description: localised reconstruction of integrin alpha v beta 6 bound to foot and mouth disease virus o1 manisa - pose a.

PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d5neta2:

Sequence, based on SEQRES records:

>d5neta2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif
meyrldyrtaadttglqpilnqftpanisrqahill

Sequence, based on observed residues (ATOM records):

>d5neta2 b.1.15.0 (A:439-594) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell
ldklkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitifme
yrldyrtaadttglqpilnqftpanisrqahill

Timeline for d5neta2:

• d5neta2 first appeared in SCOPe 2.06
  
• d5neta2 appears in SCOPe 2.07