SCOP 1.59: Domain d1ekeb_: 1eke B:

Lineage for d1ekeb_ (1eke B:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (7 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein Class II ribonuclease H (RNase HII) [53103] (3 species)

7. Species Archaeon Methanococcus jannaschii [TaxId:2190] [53104] (1 PDB entry)

8. Domain d1ekeb_: 1eke B: [33573]

Details for d1ekeb_

PDB Entry: 1eke, 2 Å

PDB Description: crystal structure of class ii ribonuclease h (rnase hii) with mes ligand

SCOP Domain Sequences for d1ekeb_:

Sequence; same for both SEQRES and ATOM records:

>d1ekeb_ c.55.3.1 (B:) Class II ribonuclease H (RNase HII) {Archaeon Methanococcus jannaschii}
miiigideagrgpvlgpmvvcafaiekereeelkklgvkdskeltknkraylkkllenlg
yvekrileaeeinqlmnsinlndieinafskvaknlieklnirddeieiyidacstntkk
fedsfkdkiediikernlnikiiaehkadakypvvsaasiiakaerdeiidyykkiygdi
gsgypsdpktikfledyfkkhkklpdiarthwktckrildkskqt

Timeline for d1ekeb_:

• d1ekeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ekeb_ appears in SCOP 1.57
  
• d1ekeb_ appears in SCOP 1.61
  
• d1ekeb_ appears in the current release, SCOPe 2.08