SCOPe 2.06: Domain d5paqa_: 5paq A:

Lineage for d5paqa_ (5paq A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d5paqa_: 5paq A: [335710]
   Other proteins in same PDB: d5paqb_
   automated match to d1klil_
   complexed with 7za, ca, cl, gol, so4

Details for d5paqa_

PDB Entry: 5paq, 1.59 Å

PDB Description: crystal structure of factor viia in complex with 2-[(1- aminoisoquinolin-6-yl)amino]-2-(3-ethoxy-4-propan-2-yloxyphenyl)-1- (2-phenylpyrrolidin-1-yl)ethanone

PDB Compounds: (A:) Coagulation factor VII light chain

SCOPe Domain Sequences for d5paqa_:

Sequence; same for both SEQRES and ATOM records:

>d5paqa_ g.3.11.1 (A:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
licvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekrna

Timeline for d5paqa_:

• d5paqa_ is new in SCOPe 2.06-stable
  
• d5paqa_ appears in SCOPe 2.07
  
• d5paqa_ appears in the current release, SCOPe 2.08