Lineage for d5l7ma_ (5l7m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2929386Family d.9.1.0: automated matches [191483] (1 protein)
    not a true family
  6. 2929387Protein automated matches [190775] (3 species)
    not a true protein
  7. 2929430Species Mouse (Mus musculus) [TaxId:10090] [279523] (3 PDB entries)
  8. 2929434Domain d5l7ma_: 5l7m A: [335648]
    automated match to d1mi2a_

Details for d5l7ma_

PDB Entry: 5l7m (more details)

PDB Description: murin cxcl13 solution structure
PDB Compounds: (A:) C-X-C motif chemokine 13

SCOPe Domain Sequences for d5l7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l7ma_ d.9.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ileahytnlkcrcsgvistvvglniidriqvtppgngcpktevviwtkmkkvicvnprak
wlqrllrhvqskslsstpqapvskrraa

SCOPe Domain Coordinates for d5l7ma_:

Click to download the PDB-style file with coordinates for d5l7ma_.
(The format of our PDB-style files is described here.)

Timeline for d5l7ma_: