Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.0: automated matches [191483] (1 protein) not a true family |
Protein automated matches [190775] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [279523] (3 PDB entries) |
Domain d5l7ma_: 5l7m A: [335648] automated match to d1mi2a_ |
PDB Entry: 5l7m (more details)
SCOPe Domain Sequences for d5l7ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l7ma_ d.9.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ileahytnlkcrcsgvistvvglniidriqvtppgngcpktevviwtkmkkvicvnprak wlqrllrhvqskslsstpqapvskrraa
Timeline for d5l7ma_: