Lineage for d5la3a3 (5la3 A:210-574)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489907Fold c.96: Fe-only hydrogenase [53919] (1 superfamily)
    consist of two intertwined domains; contains partial duplication
  4. 2489908Superfamily c.96.1: Fe-only hydrogenase [53920] (1 family) (S)
    automatically mapped to Pfam PF02906
  5. 2489909Family c.96.1.1: Fe-only hydrogenase [53921] (3 protein domains)
  6. 2489920Protein automated matches [279207] (1 species)
    not a true protein
  7. 2489921Species Clostridium pasteurianum [TaxId:1501] [279208] (7 PDB entries)
  8. 2489934Domain d5la3a3: 5la3 A:210-574 [335645]
    Other proteins in same PDB: d5la3a1, d5la3a2, d5la3a4, d5la3b1, d5la3b2, d5la3b4
    automated match to d3c8ya1
    complexed with 402, fes, mg, sf4

Details for d5la3a3

PDB Entry: 5la3 (more details), 2.29 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant e279a
PDB Compounds: (A:) Iron hydrogenase 1

SCOPe Domain Sequences for d5la3a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5la3a3 c.96.1.1 (A:210-574) automated matches {Clostridium pasteurianum [TaxId: 1501]}
hmdrvknalnapekhvivamapsvrasigelfnmgfgvdvtgkiytalrqlgfdkifdin
fgadmtimeaatelvqrienngpfpmftsccpgwvrqaenyypellnnlssakspqqifg
tasktyypsisgldpknvftvtvmpctskkfeadrpqmekdglrdidavittrelakmik
dakipfakledseadpamgeysgagaifgatggvmeaalrsakdfaenaeledieykqvr
glngikeaeveinnnkynvavingasnlfkfmksgminekqyhfievmachggcvngggq
phvnpkdlekvdikkvrasvlynqdehlskrkshentalvkmyqnyfgkpgegraheilh
fkykk

SCOPe Domain Coordinates for d5la3a3:

Click to download the PDB-style file with coordinates for d5la3a3.
(The format of our PDB-style files is described here.)

Timeline for d5la3a3: