Lineage for d5la3b1 (5la3 B:3-126)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179555Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2179556Protein automated matches [191164] (21 species)
    not a true protein
  7. 2179563Species Clostridium pasteurianum [TaxId:1501] [279203] (7 PDB entries)
  8. 2179577Domain d5la3b1: 5la3 B:3-126 [335638]
    Other proteins in same PDB: d5la3a2, d5la3a3, d5la3a4, d5la3b2, d5la3b3, d5la3b4
    automated match to d3c8ya2
    complexed with 402, fes, mg, sf4

Details for d5la3b1

PDB Entry: 5la3 (more details), 2.29 Å

PDB Description: [fefe]-hydrogenase cpi from clostridium pasteurianum, variant e279a
PDB Compounds: (B:) Iron hydrogenase 1

SCOPe Domain Sequences for d5la3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5la3b1 d.15.4.0 (B:3-126) automated matches {Clostridium pasteurianum [TaxId: 1501]}
tiiingvqfntdedttilkfardnnidisalcflnncnndinkceictvevegtglvtac
dtliedgmiintnsdavnekiksrisqlldihefkcgpcnrrenceflklvikykarask
pflp

SCOPe Domain Coordinates for d5la3b1:

Click to download the PDB-style file with coordinates for d5la3b1.
(The format of our PDB-style files is described here.)

Timeline for d5la3b1: