SCOPe 2.06: Domain d5tl5l2: 5tl5 L:111-217

Lineage for d5tl5l2 (5tl5 L:111-217)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d5tl5l2: 5tl5 L:111-217 [335577]
   Other proteins in same PDB: d5tl5l1
   automated match to d1dn0a2
   complexed with nag, so4

Details for d5tl5l2

PDB Entry: 5tl5, 1.8 Å

PDB Description: complex between human cd27 and antibody m2177

PDB Compounds: (L:) m2177 light chain

SCOPe Domain Sequences for d5tl5l2:

Sequence; same for both SEQRES and ATOM records:

>d5tl5l2 b.1.1.2 (L:111-217) automated matches {Mus musculus, [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5tl5l2:

• d5tl5l2 is new in SCOPe 2.06-stable
  
• d5tl5l2 appears in SCOPe 2.07
  
• d5tl5l2 appears in the current release, SCOPe 2.08