Lineage for d5jxxe_ (5jxx E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813832Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813833Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2814180Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2814181Protein automated matches [190967] (36 species)
    not a true protein
  7. 2814301Species Moraxella catarrhalis [TaxId:1236608] [335370] (1 PDB entry)
  8. 2814306Domain d5jxxe_: 5jxx E: [335556]
    automated match to d4e6ua_
    complexed with flc, gol

Details for d5jxxe_

PDB Entry: 5jxx (more details), 3 Å

PDB Description: crystal structure of udp-n-acetylglucosamine o-acyltransferase (lpxa) from moraxella catarrhalis rh4.
PDB Compounds: (E:) acyl-[acyl-carrier-protein]--udp-n-acetylglucosamine o-acyltransferase

SCOPe Domain Sequences for d5jxxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jxxe_ b.81.1.0 (E:) automated matches {Moraxella catarrhalis [TaxId: 1236608]}
mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf
asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah
dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv
masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk
iqllidsinnskrglv

SCOPe Domain Coordinates for d5jxxe_:

Click to download the PDB-style file with coordinates for d5jxxe_.
(The format of our PDB-style files is described here.)

Timeline for d5jxxe_: