Class a: All alpha proteins [46456] (290 folds) |
Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily) multihelical bundle; contains buried central helix |
Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) |
Family a.89.1.0: automated matches [227272] (1 protein) not a true family |
Protein automated matches [227075] (6 species) not a true protein |
Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335548] (1 PDB entry) |
Domain d5n1qb2: 5n1q B:189-443 [335554] Other proteins in same PDB: d5n1qb1, d5n1qc_, d5n1qe1, d5n1qf_ automated match to d1hbnb1 complexed with com, f43, gol, k, mg, tp7 |
PDB Entry: 5n1q (more details), 1.9 Å
SCOPe Domain Sequences for d5n1qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n1qb2 a.89.1.0 (B:189-443) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]} gyalrnimvnhyvattkknlmnavafasimeqtamfemgdaigsfermhllglayqglns dnlvidlvkanskgtvgtvvasvveraledkvivedkslesgftmykpadvakwnayaaa glvaavivncgaaraaqnvastilyyndileyetglpgtdfgraegtavgfsffshsiyg gggpgiftgnhvvtrhskgfaippvcaamcadagtqmfspektsalvgavysaidefrep lkyviegalevkdki
Timeline for d5n1qb2:
View in 3D Domains from other chains: (mouse over for more information) d5n1qc_, d5n1qe1, d5n1qe2, d5n1qf_ |