Lineage for d5n1qb1 (5n1q B:2-188)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955026Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2955165Family d.58.31.0: automated matches [227271] (1 protein)
    not a true family
  6. 2955166Protein automated matches [227074] (6 species)
    not a true protein
  7. 2955181Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335401] (1 PDB entry)
  8. 2955182Domain d5n1qb1: 5n1q B:2-188 [335553]
    Other proteins in same PDB: d5n1qb2, d5n1qe2
    automated match to d1hbnb2
    complexed with com, f43, gol, k, mg, tp7

Details for d5n1qb1

PDB Entry: 5n1q (more details), 1.9 Å

PDB Description: methyl-coenzyme m reductase iii from methanothermococcus thermolithotrophicus at 1.9 a resolution
PDB Compounds: (B:) methyl-coenzyme m reductase III from methanothermococcus thermolithotrophicus subunit beta

SCOPe Domain Sequences for d5n1qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n1qb1 d.58.31.0 (B:2-188) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]}
vkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktga
iggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskrl
evaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllga
psnmegl

SCOPe Domain Coordinates for d5n1qb1:

Click to download the PDB-style file with coordinates for d5n1qb1.
(The format of our PDB-style files is described here.)

Timeline for d5n1qb1: