Lineage for d5n74b_ (5n74 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738143Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2738144Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2738145Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
    Pfam PF03271
  6. 2738146Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)
  7. 2738147Species Human (Homo sapiens) [TaxId:9606] [140615] (14 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2738179Domain d5n74b_: 5n74 B: [335552]
    automated match to d1wu9a1

Details for d5n74b_

PDB Entry: 5n74 (more details), 2.3 Å

PDB Description: microtubule end binding protein complex
PDB Compounds: (B:) Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d5n74b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n74b_ a.245.1.1 (B:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
aaelmqqvnvlkltvedlekerdfyfgklrnielicqenegendpvlqrivdilya

SCOPe Domain Coordinates for d5n74b_:

Click to download the PDB-style file with coordinates for d5n74b_.
(The format of our PDB-style files is described here.)

Timeline for d5n74b_: