Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.0: automated matches [227271] (1 protein) not a true family |
Protein automated matches [227074] (6 species) not a true protein |
Species Methanothermococcus thermolithotrophicus [TaxId:523845] [335401] (1 PDB entry) |
Domain d5n1qe1: 5n1q E:2-188 [335547] Other proteins in same PDB: d5n1qb2, d5n1qe2 automated match to d1hbnb2 complexed with com, f43, gol, k, mg, tp7 |
PDB Entry: 5n1q (more details), 1.9 Å
SCOPe Domain Sequences for d5n1qe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n1qe1 d.58.31.0 (E:2-188) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 523845]} vkyedkislydakgnlvedgvpleaisplynptikamvknikrtvavnlagienslktga iggkgckvpgrtldlpivenaeaimdevekilritpdddtqlraindgkqlvvqvpskrl evaaeysvsmlntamalkeaiiktfdvdlfdgstihaaivgrypqvmdymggniasllga psnmegl
Timeline for d5n1qe1:
View in 3D Domains from other chains: (mouse over for more information) d5n1qb1, d5n1qb2, d5n1qc_, d5n1qf_ |