SCOPe 2.06: Domain d5b87b1: 5b87 B:1-398

Lineage for d5b87b1 (5b87 B:1-398)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (121 species)
   not a true protein

7. Species Thermococcus onnurineus [TaxId:523850] [335326] (4 PDB entries)

8. Domain d5b87b1: 5b87 B:1-398 [335540]
   Other proteins in same PDB: d5b87b2
   automated match to d1jf9a_
   complexed with ala, plp

Details for d5b87b1

PDB Entry: 5b87, 2.28 Å

PDB Description: crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution

PDB Compounds: (B:) Cysteine desulfurase

SCOPe Domain Sequences for d5b87b1:

Sequence; same for both SEQRES and ATOM records:

>d5b87b1 c.67.1.0 (B:1-398) automated matches {Thermococcus onnurineus [TaxId: 523850]}
mripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqmath
kyeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsdllp
wqrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelgkia
kdegaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtfepp
ligggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqehklv
krttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcalpv
mkklgingtvrasfhvynsleevetflgvmeelvkglk

Timeline for d5b87b1:

• d5b87b1 is new in SCOPe 2.06-stable
  
• d5b87b1 appears in SCOPe 2.07
  
• d5b87b1 appears in the current release, SCOPe 2.08