Lineage for d5t0ba_ (5t0b A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2048164Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2048165Protein automated matches [227017] (34 species)
    not a true protein
  7. 2048371Species Influenza a virus [TaxId:119212] [270847] (8 PDB entries)
  8. 2048372Domain d5t0ba_: 5t0b A: [335539]
    Other proteins in same PDB: d5t0bb_, d5t0bd_, d5t0bf_
    automated match to d4xkga_
    complexed with gal, nag, sia; mutant

Details for d5t0ba_

PDB Entry: 5t0b (more details), 2 Å

PDB Description: crystal structure of h6 hemagglutinin g225d mutant from taiwan (2013) h6n1 influenza virus in complex with 6'-sln
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d5t0ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t0ba_ b.19.1.0 (A:) automated matches {Influenza a virus [TaxId: 119212]}
pgdkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctie
gwilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfp
kstwagvdtsrgvtnacpsytidssfyrnlvwivktdsatypvikgtynntgtqpilyfw
gvhhpldttvqdnlygsgdkyvrmgtesmnfakspeiaarpavndqrsridyywsvlrpg
etlnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtitgvlrtnktfqnvs
plwigecpkyvkseslrlatglrnvpqiat

SCOPe Domain Coordinates for d5t0ba_:

Click to download the PDB-style file with coordinates for d5t0ba_.
(The format of our PDB-style files is described here.)

Timeline for d5t0ba_: