Lineage for d5w15b1 (5w15 B:1-267)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (89 species)
    not a true protein
  7. 2292196Species Burkholderia ambifaria [TaxId:398577] [335497] (1 PDB entry)
  8. 2292235Domain d5w15b1: 5w15 B:1-267 [335536]
    Other proteins in same PDB: d5w15a2, d5w15b2, d5w15c2, d5w15d2
    automated match to d4lxga_
    complexed with cl, edo, mg

Details for d5w15b1

PDB Entry: 5w15 (more details), 1.75 Å

PDB Description: crystal structure of an alpha/beta hydrolase fold protein from burkholderia ambifaria.
PDB Compounds: (B:) Alpha/beta hydrolase fold protein

SCOPe Domain Sequences for d5w15b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w15b1 c.69.1.0 (B:1-267) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mldlanrfnfeghriawgtlgegpplvlvhgtpfssqvwrriapwlarrhrvffydllgy
gqsdmpdadvslgrqnvlfgalldewkisrprvlahdyggatvlrahfldgiaysdltlv
npvaiapqgspfvrhvaqheaaftglpayahhalvsayigqavaqplsddvlsiyrapwl
tpagqaafyrqiaqmrqryiedaearyappdfpvrivwgeddrwipleqgqaladriang
klirvpraghlvqedapeaivaavldr

SCOPe Domain Coordinates for d5w15b1:

Click to download the PDB-style file with coordinates for d5w15b1.
(The format of our PDB-style files is described here.)

Timeline for d5w15b1:

  • d5w15b1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15