SCOP 1.57: Domain d1rbv__: 1rbv -

Lineage for d1rbv__ (1rbv -)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.3: Ribonuclease H-like [53098] (6 families)

5. Family c.55.3.1: Ribonuclease H [53099] (3 proteins)

6. Protein RNase H (RNase HI) [53100] (2 species)

7. Species Escherichia coli [TaxId:562] [53101] (22 PDB entries)

8. Domain d1rbv__: 1rbv - [33553]

Details for d1rbv__

PDB Entry: 1rbv, 1.8 Å

PDB Description: structural study of mutants of escherichia coli ribonuclease hi with enhanced thermostability

SCOP Domain Sequences for d1rbv__:

Sequence; same for both SEQRES and ATOM records:

>d1rbv__ c.55.3.1 (-) RNase H (RNase HI) {Escherichia coli}
mlkqveiftdgsclgnpgpggygailryrgrektfsagytrttnnrmelmaaivalealk
ehcevilstdsqyvrqgitqwihnwkkrgwktadakpvknvdlwqrldaalgqhqikwew
vkghaghpenercdelaraaamnptledtgyqvev

Timeline for d1rbv__:

• d1rbv__ first appeared (with stable ids) in SCOP 1.55
  
• d1rbv__ appears in SCOP 1.59
  
• d1rbv__ appears in the current release, SCOPe 2.08, called d1rbva_