SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5w06l2 (5w06 L:113-219)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (477 PDB entries)
  8. 2292222Domain d5w06l2: 5w06 L:113-219 [335523]
    Other proteins in same PDB: d5w06l1
    automated match to d1dn0a2
    complexed with gol

Details for d5w06l2

PDB Entry: 5w06 (more details), 2.6 Å

PDB Description: human tissue factor in complex with antibody m1587
PDB Compounds: (L:) m1587 fab light chain

SCOPe Domain Sequences for d5w06l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w06l2 b.1.1.2 (L:113-219) automated matches {Mus musculus [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5w06l2:

Click to download the PDB-style file with coordinates for d5w06l2.
(The format of our PDB-style files is described here.)

Timeline for d5w06l2:

  • d5w06l2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15