Lineage for d5w06l2 (5w06 L:113-219)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (14 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (492 PDB entries)
  8. 2292222Domain d5w06l2: 5w06 L:113-219 [335523]
    Other proteins in same PDB: d5w06l1
    automated match to d1dn0a2
    complexed with gol

Details for d5w06l2

PDB Entry: 5w06 (more details), 2.6 Å

PDB Description: human tissue factor in complex with antibody m1587
PDB Compounds: (L:) m1587 fab light chain

SCOPe Domain Sequences for d5w06l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5w06l2 b.1.1.2 (L:113-219) automated matches {Mus musculus [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5w06l2:

Click to download the PDB-style file with coordinates for d5w06l2.
(The format of our PDB-style files is described here.)

Timeline for d5w06l2:

  • d5w06l2 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15