SCOPe 2.06: Domain d5xajc2: 5xaj C:111-214

Lineage for d5xajc2 (5xaj C:111-214)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Dengue virus [TaxId:12637] [335510] (1 PDB entry)

8. Domain d5xajc2: 5xaj C:111-214 [335518]
   Other proteins in same PDB: d5xajb1, d5xajc1
   automated match to d1lila2

Details for d5xajc2

PDB Entry: 5xaj, 2.5 Å

PDB Description: structural mimicry of the dengue virus envelope glycoprotein revealed by the crystallographic study of an idiotype-anti-idiotype fab complex.

PDB Compounds: (C:) Fab E1 light chain

SCOPe Domain Sequences for d5xajc2:

Sequence; same for both SEQRES and ATOM records:

>d5xajc2 b.1.1.2 (C:111-214) automated matches {Dengue virus [TaxId: 12637]}
apkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptec

Timeline for d5xajc2:

• d5xajc2 is new in SCOPe 2.06-stable
  
• d5xajc2 appears in SCOPe 2.07
  
• d5xajc2 appears in the current release, SCOPe 2.08