Lineage for d5xajc1 (5xaj C:1-110)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2026644Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2026645Protein automated matches [190740] (27 species)
    not a true protein
  7. 2292207Species Dengue virus [TaxId:12637] [335508] (1 PDB entry)
  8. 2292216Domain d5xajc1: 5xaj C:1-110 [335517]
    Other proteins in same PDB: d5xajb2, d5xajc2
    automated match to d1lila1

Details for d5xajc1

PDB Entry: 5xaj (more details), 2.5 Å

PDB Description: structural mimicry of the dengue virus envelope glycoprotein revealed by the crystallographic study of an idiotype-anti-idiotype fab complex.
PDB Compounds: (C:) Fab E1 light chain

SCOPe Domain Sequences for d5xajc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xajc1 b.1.1.0 (C:1-110) automated matches {Dengue virus [TaxId: 12637]}
lsyeltqppsvsvapgqtarmtcggnnigtksvhwyqqkpgqapvlvvyndrdrpsgipe
rfsgsnsgntatltisrvedgdeadyfcqvwdnysdhvifgggtkltvlg

SCOPe Domain Coordinates for d5xajc1:

Click to download the PDB-style file with coordinates for d5xajc1.
(The format of our PDB-style files is described here.)

Timeline for d5xajc1:

  • d5xajc1 appears in periodic updates to SCOPe 2.06 starting on 2017-06-15

View in 3D
Domains from same chain:
(mouse over for more information)
d5xajc2